PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G190900.3
Common NameB456_006G190900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 464aa    MW: 51357.2 Da    PI: 7.804
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G190900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31280333255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gorai.006G190900.3 280 PRMRWTSSLHARFVRAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 333
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-28277334IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15277334IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-24280333IPR006447Myb domain, plants
PfamPF002495.4E-7281332IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
QTHPPFLPNS FLYAFHHYFI IICNTSHLSQ HVCSFYFFSS YKLFFGDLGQ QQYLETLELG  60
TVMFNKGDLR EQYMNRVPDL SLQISPPNPA PSTACTGNSS FDIWCRKDAL NSLTYGSQAD  120
TQLSLANPAS SASQIDSPSP NYFPTTYDDQ TRHRNLLKCG QNGGQLSNIN HGISLLDVPG  180
PKPTKGIPVY SNTMSLPFLS SDSFVDMDPD KLGFYSSSVA SVLHSADACR RASEAARFNG  240
ISLEKLGPQF HHHYAQHGAA MGSSRFIPKL QSSKRNTRTP RMRWTSSLHA RFVRAVELLG  300
GHERATPKSV LELMDVKDLT LSHVKSHLQM YRTVKSSDKP ASSSEKIRNE GECAEEDCLG  360
VSRNTVSGND KCSEKQGSTS PNLSIQHDYD ENNNSIHLWT NSSRGVGLLS WRNPDECRPQ  420
APSSSQSGKQ FDGSSFSQQI LRVSSVELQN PSLHFSLGKQ TTD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486375.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A0D2QD170.0A0A0D2QD17_G
STRINGPOPTR_0012s03900.19e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-46G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]